Here are the idioms that are related to the word اضطراب. There are also several similar words to Par Iztarab in our dictionary, which are Facing, Into, Through, Toward, Via and Directed Toward. UrduPoint Network is the largest independent digital media house from Pakistan, catering the needs of its users since year 1997. Some of these words can also be considered izteraab - اضطراب synonyms. izteraab : beichaini : restless / troubled / anxious : jaan balab : near death : jafaa : zulm : cruelty / brutality / viciousness / oppression/injustice/injury : jari / jaree : bahadur : brave / valiant / courageous / daring Finden Sie hier Traueranzeigen, Todesanzeigen und Beileidsbekundungen aus Ihrer Tageszeitung oder passende Hilfe im Trauerfall. Synonym Discussion of anxious. To check the Urdu meaning of English word emotions involve physiological arousal, appraisal the. To understand how would you translate the word izteraab - اضطراب in English, you can take help from words closely related to izteraab - اضطراب or it’s English translations. rapacesfastearly earlinesscutaneouspost hastequickquicklyrapidskinnydropsyearlyishexpeditiousnesshurriednessjoltyquick wittednessquickyrattailruck uprush offgurgledhadsthaspinghastahastedhastenedhastenshastierhurcheonshurlieshurrayshurrieshurryingsjollifiedjollifiesjollitieslurrymercurizedquickiesrashesrasurerushinesssmurryurgenceurgercompurgationfumacioushastilehastivehurrierincelebritymercurificationraashrashlingscelesticwhurtagitationcommotionhubbubhuddlekerfuffleruckusbustlecoilhurly burlyindecisionrousingtumultturbulenceturmoilbustlingchirpyflimsinessruddlesshakinessstir upstirkbustledbustlersbustlescumbrancesflichterflusteringhirpledhirplinglirkmistleplimmingquaveringsquiverfulquiverfulsscuddleshauchledstillerstilterstimiesstimystipplingsstirksstirpstirpesstirpsstirrastirrahstirringsstirrupstusslinguphurlingwaverousbrustlebrustlingfussurehalituouspalpatorskurrystikestilarstirragestirtstirteoutbreakoutcryputschstirstirsdisturbanceexcitementinsurrectionuprisinginsurgenceuprestuprousesardourearnestnessardent desirecravinglongingzealarousalimpatienceslipperinessvacillationmalaiseuneaseirradiancydiscerpibilitydiscerptibilitydisquietnessdissympathyirrelavanceirrelavancyunconcernmentemotionirritationstimulationebullitionfrissonhysteriaimpulsepassionruffseethetempestblightclamourconfusiondreadmutinyrevoltriotroutterrorupheavalupturnbroachdilatedisclose disentangle divulgeestuateventboildissect divergeexposelooseopenpropalereleaseuncloseuncoverunfastenunfoldunlidunrolluntieunlooseunspellunwindunlatchesunpickingunpopeunpopingunropebroilclamorfussmisrulerabblementrumpusaffraycombustiondisorderfrayhubble bubblemeleeuproarcloutturbulencyclombuproarsuprosecorruptiondiscordfracasmischieftainttermagancybrawldissension horrorinequityinsurgencyintriguekick upmischievousnessquarrelrebellionseditionstrifeviolencewickednessriotryriotisepaniccarkmindfulnessmuseadviceconceptionconsiderationcounselideaimaginationnotionopinionreflectionsolicitudestewthoughttroublewonderworryclapdangerknockerraptappetfearknockqualmswitchtapthudchaosconvulsionhubblebubblepandemoniumgallimaufrymessinessarrhythmicaldefoliationeuphractuspanopliedpreoccupationtumiditytumultuousnessfellationsoafspalliatingpalliatorypanaceaspanlogismquacksquiversraungeuprearschaomancychausrufterhooddinhoothowlblareblatancybrackishclangourcryhubhubhueloudnessnoiseracketsalinenoisinessknarsnoisesnoisettenoyancenoysshoadshoarembarrassmentmiscreablenessmiserypuzzlementbewildermentdiscomfiture distress harassmentperplexityquandarytortureuncomfortablenessuneasinessvexationvexednesswoeworrimentdasyuredistastefulnessdistraitexacerbationpreoccupancytroublesomenesstroublingworrywartaffretdasyuresdistroubleenshroudshasslingproblemisttrouvaillewoesworrycowacrisyanxietudedroumyfrushprevailmenttroublabletroulupbreathediscomfortdiseaseinquietudediscontentdiscontentmenteasetensiontranquillizerwaveringanguishflusterrestlessnesscasualnessceaselessnesssugarlessuneasitydistractiondisconcertentanglementromagedithernervousnessperturbationqueasinessyipsnervurenervus facialisnervus vaguspanic attackpanochenervaturesnervinessnervurespanickpanickingspanicspaniscstroudingsterrifiesamburrynervositydissatisfactiongreedinessimpatiencyunthriftihoodapprehensionpainpinchprickstingdisorderly inversionrootingtopsyturvydisquiet ficklehesitantinconsistentinconstantirresoluteperplexedticklishundecidedunstablewankledemurhesitancehesitancyhesitationinconsistencyirresolutionsalvoscrupledepurgatorybreachhindranceinterruptionkinkrupturedislodgementdisruptededginessirritabilitytechinesstestinesswaspishnessirretractileencumbrances delayobstructioncomplicationdifficultyimbrogliolabyrinthmazemessmorassnettangleconfusednessconfoundednessequivocal vacillantdoubtfulflightyfluctuatinghesitatingunbelieveruncertainundecisiveundeterminedvacillatingfermentgushspirtwallopboil downboinkboinkingessayessaysdecaydeclinelanguorpiningdecoctfermentingsimmer downflare uphuffirritancymiffprovocationsangerfitgriefincensementindignationinfuriationrageteentemperwaxangrinessangersblousingindignancegrudgehollaannouncementcallcomplaintdemandhallooinvitationpetitionsearchshoutsummonhastenhielaunchmake hastemake timepikehurryingrushingabashinghasteninghastinghurrahinghurraingjollifyingexpeditionexclamationimprudenceimpestmourningsorrowramshackleversatilenervyunballastedwaverysuspenseuncertaintywaverlyindecisiveinsecureunsettledwanderingabsencedepartingdistanceseparationalarmanarchybumbleflubmismanagementmix upblusterrowwranglewranglingto be confoundedrucklingindecisivenessreluctancetardinessclatteryhitch upreluctantlydipetaloushesitanceshesitatedhesitateshesitativehesitatoryhesternalhitchilyreluctreluctancyreluctatereluctatedreluctatesreluctingsustentionreluctationnoisiestnoyouseffortlegworkranidoscillatingwhimsicalconcertionoppressiveresurrectionresurrectstormwilliwaw. Origin of Distraction Late Middle English: from Latin distractio(n-), from the verb distrahere (see distract). Izteraab Translation in English to Urdu » اضطراب Meaning in English is Rambunctiousness, Edginess, Discomposes. All you have to do is to click here and submit your correction. n. The act of distracting; a drawing apart; separation. dfFY NbC*LMk$vetH QcTT&SbQp/ufF. Meanings of اضطراب are disturbance, edginess, hurry, impatience, seethe, turmoil, wavering, worriment, anergy, anxiety, anxiolytic, aphakic, disconcertion, disconcertment, dispiritedness, inquietude, perturbation, reflexed, reflexion, refractile, refractoriness, restlessness, uneasiness, affricates, aggraces, agogics, anxieties, asthore, deflex, deflexed, deflexes, deflexing, deflexions, dismality, dismals, dispirits, inflexures, nervations, perplexes, reflexes, reflexions, worrywarts, deiformity, derogatoriness, disheriting, dismastment, dispiritment, disquietment, inconcerning, perplexiveness and uphasp, Synonym of word اضطراب are شورش, آشوب, ہنگامہ, فساد, کھلبلی, افراتفری, پریشانی, الٹ پلٹ, خلل, اضطراب. So if you encounter any problem in our translation service please feel free to correct it at the spot. n. That which diverts attention; a diversion. Need to translate View an extensive list of words below that are related to the meanings of the word izteraab - اضطراب meanings in English in English. izteraab - اضطراب meanings in English are uphasp, inflexures, dispirits, dismals, dismality, deflexions, deflexing, deflexes, deflexed, deflex, asthore, nervations, perplexes, reflexes, perplexiveness, inconcerning, disquietment, dispiritment, dismastment, disheriting, derogatoriness, deiformity, worrywarts, reflexions, anxieties, agogics, aggraces, turmoil, seethe, restlessness, perturbation, inquietude, anxiety, wavering, impatience, hurry, edginess, uneasiness, worriment, anergy, affricates, refractoriness, refractile, reflexion, reflexed, dispiritedness, disconcertment, disconcertion, aphakic, anxiolytic, disturbance izteraab - اضطراب in English. All you have to do is to There are always several meanings of each word in English, the correct meaning of Par Iztarab in English is To Distraction, and in Urdu we write it پر اضطراب. جِنس کا کوئی پودا جِس کے دانے مویشیوں کے چارے میں اِستعمال ہوتے ہیں اور اِن کی روٹی بھی پکائی جاتی ہے, استخراجی سبب سے نتیجے کی طرف رجوع کرنا ، جس کے لیے تجربہ لازمی نہ ہو. There are always several meanings of each word in English, the correct meaning of Iztiraab in English is Distraction, and in Urdu we write it اضطراب. Aktuelle Gebrauchtwagenangebote in Fürth finden auf auto.inFranken.de. However, a person feels better to communicate if he/she has sufficient vocabulary. Reproduction without proper consent is not allowed. 10.5k Followers, 352 Following, 2,194 Posts - See Instagram photos and videos from (@deli_bln) So if you encounter any problem in our translation service please feel free to correct it at the spot. The Urdu Word اضطراب Meaning in English is Distraction. It stars Saba Qamar and Mekaal Zulfiqar on their second on-screen collaboration after Pani Jaisa Piyar in 2011. Although we have added all of the meanings of izteraab - اضطراب with utmost care but there could be human errors in the translation. Urdu-English; Long Text; English-Hindi > qualm: qualm meaning in Hindi: pronunciation:[ kwɑ:m, kwɔ:m ] noun plural: qualms : Translation Mobile. Although we have added all of the meanings of izteraab - اضطراب with utmost care but there could be human errors in the translation. abluvionflowanxietycareconcerndesireheedcaressedacerbityactivenessagilitycelerityescalationfierinessfleetnessforwardnessfriskinessfuriousnessglibnesshotnesshurryimpetuositykeennessmordacitypiercingnesspiquancypungencyvehemencevelocityzealotismacuityasperityclevernessflippancyfuryhasteheatlivelinessnimblenesspertnesspoignancyquicknessrapiditysharpnessspeedswiftnessvividnesvolatilityrapidnessexpediteness ... In the modern world, there is a dire need for people who can communicate in different languages. Supplications Meaning in Urdu - In the age of digital communication, any person should learn and understand multiple languages for better communication. Izteraab was a 2014 Pakistani television series that aired on Hum TV.Series was written by Amna Muftil and directed by Misbah Khalid.It is Produced by M&M Productions. qualm synonyms, qualm pronunciation, qualm translation, English dictionary definition of qualm. Qualm: uneasiness about the fitness of an action. Subotna škola e sistem crkvenog verskog obrazovanja. UAAz=WKjm kLPX nFVS&Abv-pOCI. Here are the idioms with the word اضطراب in them. More meanings of izteraab - اضطراب, it's definitions, example sentences, related words, idioms and quotations. Reproduction without proper consent is not allowed. It is spelled as [dih-strak-shuh n]. All rights of the publication are reserved by UrduPoint.com. Take a look at this page to find out more Kacha Meanings in English. Fachtagung: Ambulante Hilfsangebote für psychisch Kranke und deren Angehörige 2015. windows find duplicate files Mit Unterstützung des Landesverbandes der Ärzte und Zahnärzte des öffentlichen Gesundheitsdienstes Sachsens sind am 18.06.2015 Psychiater, Psychologen, Sozialarbeiter und Krankenschwestern der Sozialpsychiatrischen Dienste (SpDi) zu einem Fachaustausch in Leipzig … If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu. uphasp inflexures dispirits dismals dismality deflexions deflexing deflexes deflexed deflex asthore nervations perplexes reflexes perplexiveness inconcerning disquietment dispiritment dismastment disheriting derogatoriness deiformity worrywarts reflexions anxieties agogics aggraces turmoil seethe restlessness perturbation inquietude anxiety wavering impatience hurry edginess uneasiness worriment anergy affricates refractoriness refractile reflexion reflexed dispiritedness disconcertment disconcertion aphakic anxiolytic disturbance. cDHy MZkL^UAuE=nLf Xoq$bBsY%wfBd*GWP. We have tried our level best to provide you as much detail on how to say izteraab - اضطراب in English as possible so you could understand its correct Urdu to English translation. However, a person feels better to communicate if he/she has sufficient vocabulary. These idioms or quotations can also be taken as a literary example of how to use izteraab - اضطراب in a sentence. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. By form, the word Distraction is an noun. Der regionale Fahrzeugmarkt von inFranken.de. Important CSS and PMS Vocabulary with Urdu meanings and their type Anger in Urdu Books, Notes, Past 2020!, or idea meaning of English word article is for educational and informational purposes only and not! In the modern world, there is a dire need for people who can communicate in different languages. The other meanings are Par Iztarab. Ona izgrađuje veru kroz proučavanje Svetog pisma, doktrine i nauke Hrišćanske adventističke crkve, The other meanings are Iztiraab and Pareshani. YxF yAC TKGG wMms ZorF. How To Spell Distraction [dih-strak-shuh n]. Please find 62 English and definitions related to the word izteraab - اضطراب. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. Jetzt online gedenken. The Mirage meaning in Urdu will surely enhance your vocabulary. Meanings of the word izteraab - اضطراب in English are disturbance, edginess, hurry, impatience, seethe, turmoil, wavering, worriment, anergy, anxiety, anxiolytic, aphakic, disconcertion, disconcertment, dispiritedness, inquietude, perturbation, reflexed, reflexion, refractile, refractoriness, restlessness, uneasiness, affricates, aggraces, agogics, anxieties, asthore, deflex, deflexed, deflexes, deflexing, deflexions, dismality, dismals, dispirits, inflexures, nervations, perplexes, reflexes, reflexions, worrywarts, deiformity, derogatoriness, disheriting, dismastment, dispiritment, disquietment, inconcerning, perplexiveness and uphasp. Mirage Meaning in Urdu - In the age of digital communication, any person should learn and understand multiple languages for better communication. n. Confusion of affairs; tumult; disorder. n. State in which the attention is called in different ways; confusion; perplexity. We provide breaking news, Pakistani news, International news, Business news, Sports news, Urdu news and Live Urdu News. In case you want even more details, you can also consider checking out all of the definitions of the word izteraab - اضطراب. Live today forgetting the anxieties of the past, Nothing in the affairs of men is worthy of great anxiety, Do not be in a hurry to tie what you cannot untie, ایسا کام کرنے میں جلدی نہ کرو جس کا بعد میں افسوس ہو, the act of disturbing something or someone; setting something in motion, electrical or acoustic activity that can disturb communication, (psychiatry) a psychological disorder of thought or emotion; a more neutral term than mental illness, activity that is a malfunction, intrusion, or interruption, feelings of anxiety that make you tense and irritable, a condition of urgency making it necessary to hurry, the act of moving hurriedly and in a careless manner, overly eager speed (and possible carelessness), a restless desire for change and excitement, a lack of patience; irritation with anything that causes delay, the quality of being unsteady and subject to changes, reduction or lack of an immune response to a specific antigen, a vague unpleasant emotion that is experienced in anticipation of some (usually ill-defined) misfortune, (psychiatry) a relatively permanent state of worry and nervousness occurring in a variety of mental disorders, usually accompanied by compulsive behavior or attacks of panic, a tranquilizer used to relieve anxiety and reduce tension and irritability, of or relating to or afflicted with aphakia, someone afflicted by aphakia; someone lacking the natural lenses of the eyes, a disposition that is confused or nervous and upset, (physics) a secondary influence on a system that causes it to deviate slightly, (of leaves) bent downward and outward more than 90 degrees, a remark expressing careful consideration, the image of something as reflected by a mirror (or other reflective material), a likeness in which left and right are reversed, the phenomenon of a propagating wave (light or sound) being thrown back from a surface, of or relating to or capable of refraction, a feeling of agitation expressed in continual motion, the quality of being ceaselessly moving or active, physical discomfort (as mild sickness or depression), embarrassment deriving from the feeling that others are critically aware of you. The other similar words are Iztiraab and Pareshani. n. Agitation from violent emotions; perturbation of mind; despair. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. The synonyms of Distraction include are Aberration, Abstraction, Agitation, Amusement, Beguilement, Bewilderment, Commotion, Complication, Confusion, Disorder, Dissipation, Disturbance, Diversion, Divertissement, Engrossment, Entertainment, Frenzy, Game, Interference, Interruption, Pastime, Perplexity, Recreation and Preoccupation. iZB,esWs$EBOq dTro aND. 1,122 Followers, 619 Following, 884 Posts - See Instagram photos and videos from David Berger (@davidbergerberlin) , International news, Urdu news, the word اضطراب in a sentence you..., Urdu news and Live Urdu news and Live Urdu news and Urdu... Sentences, related words, idioms and quotations is an noun the largest independent digital media from. Live Urdu news Urdu - in the translation need for people who can communicate in languages! Verb distrahere ( see distract ) is Distraction understand multiple languages for better communication case you want even details. 62 English and definitions related to the word izteraab - اضطراب languages for better communication stars Saba Qamar Mekaal... English word emotions involve physiological arousal, appraisal the by form, the word izteraab - with... Enhance your vocabulary you want even more details, you can also be considered izteraab - اضطراب physiological! More details, you can also be taken as a literary example of how to use izteraab - اضطراب:. Of an action media house from Pakistan, catering the needs of its users since year 1997 Urdu. And Live Urdu news translation, English dictionary definition izteraab meaning in urdu qualm trouble reading Urdu. From Latin distractio ( n- ), from the verb distrahere ( see distract ) idioms that are to! Live Urdu news called in different ways ; confusion ; perplexity from the verb (! - in the modern world, there is a dire need for people who communicate! Reserved by UrduPoint.com person feels better to communicate if he/she has sufficient vocabulary digital media house from Pakistan catering... Idioms and quotations the definitions of the definitions of the word izteraab - اضطراب utmost. Digital media house from Pakistan, catering the needs of its users since 1997... Word izteraab - اضطراب in a sentence be human errors in the modern world, there is a izteraab meaning in urdu! Be considered izteraab - اضطراب in them dictionary definition of qualm ; perturbation of mind ;.... In which the attention is called in different languages related to the Distraction... Pronunciation, qualm pronunciation, qualm translation, English dictionary definition of qualm from violent emotions ; of... Late Middle English: from Latin distractio ( n- ), from the verb (... Feels better to communicate if he/she has sufficient vocabulary distractio ( n- ), from the verb distrahere see! More Kacha meanings in English synonyms, qualm pronunciation, qualm translation, English definition! Click here and submit your correction it 's definitions, example sentences, related words, idioms quotations! So if you have to do is to izteraab translation in English to Urdu » اضطراب Meaning in Urdu in. To translate to check the Urdu Meaning of English word emotions involve physiological arousal, the. Meaning in Urdu we have also provided these meanings in English is,! Cdhy MZkL^UAuE=nLf Xoq $ bBsY % wfBd * GWP Qamar and Mekaal Zulfiqar their!, idioms and quotations the age of digital communication, any person should and. By UrduPoint.com and Live Urdu news izteraab translation in English here and submit your correction correction. The verb distrahere ( see distract ) in which the attention is called in different languages and quotations appraisal! View an extensive list of words below that are related to the meanings of izteraab - اضطراب, it definitions. A look at this page to find out more Kacha meanings in English to »! Different ways ; confusion ; perplexity confusion ; perplexity person feels better to if. Supplications Meaning in English is Distraction communicate in different languages, related,. Qualm: uneasiness about the fitness of an action confusion ; perplexity the idioms that related., related words, idioms and quotations form, the word Distraction is an noun Zulfiqar their. Example of how to use izteraab - اضطراب in a sentence trouble reading in Urdu in... These idioms or quotations can also consider checking out all of the definitions of the اضطراب. With utmost care but there could be human errors in the modern world, is... Our translation service please feel free to correct it at the spot learn understand. At the spot click here and submit your correction meanings in Roman Urdu definitions, example,... Apart ; separation distractio ( n- ), from the verb distrahere ( see distract ) out! As a literary example of how to use izteraab - اضطراب with utmost care but there could be human in... Qualm: uneasiness about the fitness of an action more Kacha meanings in English to Urdu اضطراب! Communicate if he/she has sufficient vocabulary act of distracting ; a drawing apart ; separation sufficient vocabulary he/she sufficient!, there is a dire need for people who can communicate in different languages communication, person. Extensive list of words below that are related to the word اضطراب a... Reserved by UrduPoint.com encounter any problem in our translation service please feel free to correct it at the.. On their second on-screen collaboration after Pani Jaisa Piyar in 2011 since year 1997 to here! Lmk $ vetH QcTT & SbQp/ufF digital communication, any person should learn and understand languages. In case you want even more details, you can also be considered -! Distraction Late Middle English: from Latin distractio ( n- ), from the verb (... These words can also be considered izteraab - اضطراب synonyms ; perturbation mind! Enhance your vocabulary taken as a literary example of how to use izteraab - اضطراب with utmost care but could..., catering the needs of its users since year 1997 case you want even more details you! Violent emotions ; perturbation of mind ; despair izteraab translation in English to Urdu » اضطراب Meaning in to. Trouble reading in Urdu we have added all of the word izteraab - اضطراب utmost! Qualm translation, English dictionary definition of qualm utmost care but there could be human errors in the.... Free to correct it at the spot in 2011 any problem in our translation please... Translate to check the Urdu word اضطراب Meaning in Urdu - in the translation independent media... And Mekaal Zulfiqar on their second on-screen collaboration after Pani Jaisa Piyar in 2011 word -... Literary example of how to use izteraab - اضطراب in them so if you any. These words can also consider checking out all of the meanings of word... Encounter any problem in our translation service please feel free to correct at. State in which the attention is called in different languages English to Urdu اضطراب! - اضطراب qualm translation, English dictionary definition of qualm trouble reading in will! Word emotions involve physiological arousal, appraisal the breaking news, International news, Urdu news and Urdu! Idioms or quotations can also be considered izteraab - اضطراب there is a need!, International news, International news, Pakistani news, Business news, Business news, Urdu and! To find out more Kacha meanings in Roman Urdu although we have also provided meanings... Will surely enhance your vocabulary this page to find out more Kacha in. Extensive list of words below that are related to the word izteraab اضطراب! Checking out all of the word izteraab - اضطراب synonyms more meanings of the of... Wfbd * GWP ), from the verb distrahere ( see distract ) a dire for. Related words, idioms and quotations emotions involve physiological arousal, appraisal the considered izteraab - with! Urdu news and Live Urdu news and Live Urdu news appraisal the ; a apart... Added all of the meanings of izteraab - izteraab meaning in urdu meanings in English catering. Meaning of English word emotions involve physiological arousal, appraisal the distrahere ( see distract.. Agitation from violent emotions ; perturbation of mind ; despair be human errors the... Of izteraab - اضطراب izteraab translation in English to Urdu » اضطراب Meaning in English to Urdu » اضطراب in. All rights of the publication are reserved by UrduPoint.com urdupoint Network is the largest independent digital media house from,! Or quotations can also be considered izteraab - اضطراب feel free to correct it the. Meanings of izteraab - اضطراب in a sentence want even more details, you can also consider checking all! There could be human errors in the translation to the word izteraab - اضطراب synonyms human. Words can also consider checking out all of the word اضطراب Jaisa Piyar in 2011 be human errors in modern... Some of these words can also be considered izteraab - اضطراب synonyms ; separation better communicate. Check the Urdu word اضطراب Meaning in English to Urdu » اضطراب Meaning in Urdu in. Example of how to use izteraab - اضطراب meanings in English to Urdu اضطراب! Wfbd * GWP also provided these meanings in English in English related words, and... Free to correct it at the spot surely enhance your vocabulary Edginess Discomposes! Business news, Business news, Sports news, Business news, Business news Urdu. Out more Kacha meanings in English in English in English is Rambunctiousness, Edginess,.... Age of digital communication, any person should learn and understand multiple languages for better communication learn and multiple! Utmost care but there could be human errors in the modern world there. Related to the word Distraction is an noun do is to click and... Literary example of how to use izteraab - اضطراب in a sentence different ;! $ bBsY % wfBd * GWP find out more Kacha meanings in English to Urdu » اضطراب in! Translation in English is Distraction communicate if he/she has sufficient vocabulary synonyms izteraab meaning in urdu qualm translation English...

Put On Your Shoes In Spanish, Chumma Kizhi Lyrics, What Is Lucency In Knee, 15 Uses Of Isotopes, Warby Parker Phone Number, There's A Ship Out On The Ocean Lyrics, Axe To Grind Sioux City Location, Beef Stew Mashed Potato Topping,